Antibodies

Jump to Filters
View as table Download
SIX1 Rabbit Polyclonal Antibody
TA330272

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIX1 antibody: synthetic peptide directed towards the middle region of human SIX1. Synthetic peptide located within the following region: SEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQH
SIX1 Rabbit Polyclonal Antibody
TA343571

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIX1 antibody: synthetic peptide directed towards the middle region of human SIX1. Synthetic peptide located within the following region: LQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLG
SIX1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF504057

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIX1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIX1 Rabbit Polyclonal Antibody
TA381516

USD 220.00

3 Weeks

SIX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human SIX1 (NP_005973.1).
Modifications Unmodified
SIX1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA504057

USD 379.00

In Stock

SIX1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIX1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA504057S

USD 159.00

In Stock

SIX1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated