Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SLC22A5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 180 amino acids of human solute carrier family 22 (organic cation/carnitine transporter), member 5 |
Rabbit Polyclonal Anti-SLC22A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A5 antibody is: synthetic peptide directed towards the C-terminal region of SLC22A5. Synthetic peptide located within the following region: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST |
SLC22A5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC22A5 |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC22A5
Reactivities
- Human