Antibodies

Jump to Filters
View as table Download
ZP4 Rabbit Polyclonal Antibody
TA315686

USD 345.00

In Stock

Rabbit polyclonal anti-ZP4 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZP4.
ZP4 Rabbit Polyclonal Antibody
TA338463

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZP4 antibody: synthetic peptide directed towards the N terminal of human ZP4. Synthetic peptide located within the following region: MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT