Antibodies

View as table Download

Goat Polyclonal Antibody against KPNA2

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVQDGAPGTFNF, from the C Terminus of the protein sequence according to NP_002257.1.

Rabbit Polyclonal KPNA2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KPNA2 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human KPNA2. The immunogen is located within amino acids 40 - 90 of KPNA2.

KPNA2 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KPNA2

Rabbit polyclonal antibody to karyopherin alpha 2 (karyopherin alpha 2 (RAG cohort 1, importin alpha 1))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 468 and 529 of KPNA2 (Uniprot ID#P52292)

Rabbit Polyclonal Anti-KPNA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2. Synthetic peptide located within the following region: GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ

KPNA2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KPNA2

KPNA2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KPNA2