Antibodies

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346117

USD 475.00

5 Days

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT
MASP2 Rabbit Polyclonal Antibody
TA350706

USD 345.00

In Stock

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2
MASP2 Rabbit Polyclonal Antibody
TA366823

USD 380.00

4 Weeks

MASP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2
MASP2 Rabbit Polyclonal Antibody
TA378353

USD 220.00

3 Weeks

MASP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 445-686 of human MASP2 (NP_006601.2).
Modifications Unmodified