Antibodies

View as table Download

Rabbit Polyclonal Anti-PRDX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV

Rabbit anti-PRDX1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX1

Goat Anti-PRDX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDPKRTIAQDYG, from the internal region of the protein sequence according to NP_859048.1.

Anti-PRDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 103-115 amino acids of human peroxiredoxin 1

Anti-PRDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 103-115 amino acids of human peroxiredoxin 1

Peroxiredoxin 1/PAG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human Peroxiredoxin 1/PAG (NP_001189360.1).
Modifications Unmodified