Antibodies

Jump to Filters
View as table Download
RBM10 Rabbit Polyclonal Antibody
TA329114

USD 310.00

5 Days

Rabbit Polyclonal anti-RBM10 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10. Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
RBM10 Rabbit Polyclonal Antibody
TA366073

USD 380.00

4 Weeks

RBM10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBM10
RBM10 Rabbit Polyclonal Antibody
TA370428

USD 380.00

4 Weeks

RBM10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBM10