Antibodies

Jump to Filters
View as table Download
Rnf6 Rabbit Polyclonal Antibody
TA329953

USD 310.00

5 Days

Rabbit Polyclonal Anti-RNF6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF6 antibody: synthetic peptide directed towards the N terminal of mouse RNF6. Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
RNF6 Rabbit Polyclonal Antibody
TA381001

USD 220.00

3 Weeks

RNF6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RNF6 (NP_898864.1).
Modifications Unmodified