Rnf6 Rabbit Polyclonal Antibody

CAT#: TA329953

Rabbit Polyclonal Anti-RNF6 Antibody

Product Images

WB Suggested Anti-RNF6 Antibody Titration: 1.25ug/ml; Positive Control: SP2/0 cell lysate

• 

  Mouse Pancreas

• 

  Mouse intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF6 antibody: synthetic peptide directed towards the N terminal of mouse RNF6. Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: ring finger protein (C3H2C3 type) 6
• Database Link:
  NP_083050
  Entrez Gene 74132 Mouse
  UniProt ID Q9DBU5
• Background: Rnf6 is involved in neuronal development. High Rnf6 protein levels can be detected in developing axonal projections of motor and DRG neurons during mouse embryogenesis.
• Synonyms: DKFZp686P0776; OTTHUMP00000018154
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%