Antibodies

View as table Download

Rabbit Polyclonal Anti-RNF6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF6 antibody: synthetic peptide directed towards the N terminal of mouse RNF6. Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM

Rabbit polyclonal anti-RNF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RNF6.

RNF6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNF6

RNF6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF6

RNF6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RNF6 (NP_898864.1).
Modifications Unmodified