Antibodies

View as table Download

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL

Carrier-free (BSA/glycerol-free) SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SREBF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 407-421 amino acids of human sterol regulatory element binding transcription factor 2

Anti-SREBF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 407-421 amino acids of human sterol regulatory element binding transcription factor 2

SREBP2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SREBF2 (NP_004590.2).
Modifications Unmodified

SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated