Antibodies

Jump to Filters
View as table Download
STYK1 Rabbit Polyclonal Antibody
TA342380

USD 375.00

5 Days

Rabbit Polyclonal Anti-Styk1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Styk1 antibody is: synthetic peptide directed towards the middle region of Mouse Styk1. Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA