Antibodies

View as table Download

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Chicken, Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

CTSK rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTSK

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

Goat Polyclonal Antibody against CTSK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1.

Rabbit Polyclonal Anti-CTSK Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY

Rabbit Polyclonal Anti-CTSK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTSK

CTSK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-329 of human CTSK (NP_000387.1).
Modifications Unmodified

CTSK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-329 of human CTSK (NP_000387.1).
Modifications Unmodified