Rabbit Polyclonal Anti-Arsg Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arsg Antibody is: synthetic peptide directed towards the middle region of Rat Arsg. Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI4H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI2D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ARSG Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARSG |
Arsg Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
ARSG rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARSG |
ARSG Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human ARSG (NP_001254656.1). |
| Modifications | Unmodified |
ARSG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human ARSG (NP_001254656.1). |
ARSG mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI2A8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI2A8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ARSG mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARSG mouse monoclonal antibody,clone OTI4H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI4H3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI4H3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ARSG mouse monoclonal antibody,clone OTI4H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARSG mouse monoclonal antibody,clone OTI2D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARSG mouse monoclonal antibody,clone OTI2D12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI2D12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ARSG mouse monoclonal antibody,clone OTI2D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China