Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP |
BPNT1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human BPNT1 |
Goat Polyclonal Antibody against BPNT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4. |
Germany
Japan
United Kingdom
China