Rabbit polyclonal Anti-FLJ37543 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-FLJ37543 antibody: synthetic peptide directed towards the N terminal of human FLJ37543. Synthetic peptide located within the following region: MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP |
Rabbit polyclonal Anti-FLJ37543 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-FLJ37543 antibody: synthetic peptide directed towards the middle region of human FLJ37543. Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS |
Germany
Japan
United Kingdom
China