C5orf64 Rabbit Polyclonal Antibody

CAT#: TA331409

Rabbit polyclonal Anti-FLJ37543 Antibody

Product Images

WB Suggested Anti-FLJ37543 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLJ37543 antibody: synthetic peptide directed towards the middle region of human FLJ37543. Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: chromosome 5 open reading frame 64
• Database Link:
  NP_775938
  Entrez Gene 285668 Human
• Background: The specific function of the protein remains unknown.
• Synonyms: FLJ37543; FLJ45901; MGC138187; MGC138213
• Note: Human: 100%