Antibodies

Jump to Filters
View as table Download
CRISPLD2 Rabbit Polyclonal Antibody
TA339581

USD 375.00

5 Days

Rabbit Polyclonal Anti-CRISPLD2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRISPLD2 antibody: synthetic peptide directed towards the N terminal of human CRISPLD2. Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
CRISPLD2 Rabbit Polyclonal Antibody
TA375096

USD 220.00

3 Weeks

CRISPLD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-430 of human CRISPLD2 (NP_113664.1).
Modifications Unmodified