CRISPLD2 Rabbit Polyclonal Antibody

CAT#: TA339581

Rabbit Polyclonal Anti-CRISPLD2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CRISPLD2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CRISPLD2 antibody: synthetic peptide directed towards the N terminal of human CRISPLD2. Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name cysteine rich secretory protein LCCL domain containing 2
Background CRISPLD2 is a novel NSCLP candidate gene.
Synonyms CRISP11; LCRISP2
Note Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.