Antibodies

Jump to Filters
View as table Download
DNER Rabbit Polyclonal Antibody
TA339792

USD 310.00

5 Days

Rabbit Polyclonal Anti-DNER Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER. Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
DNER Rabbit Polyclonal Antibody
TA375549

USD 220.00

3 Weeks

DNER Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DNER (NP_620711.3).
Modifications Unmodified