DNER Rabbit Polyclonal Antibody

CAT#: TA339792

Rabbit Polyclonal Anti-DNER Antibody

Product Images

WB Suggested Anti-DNER Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER. Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: delta/notch like EGF repeat containing
• Database Link:
  NP_620711
  Entrez Gene 92737 Human
  UniProt ID Q8NFT8
• Background: DNER is an activator of the NOTCH1 pathway. It may mediate neuron-glia interaction during astrocytogenesis.
• Synonyms: bet; UNQ26
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane