GPNMB mouse monoclonal antibody, clone 3A5, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
GPNMB mouse monoclonal antibody, clone 3A5, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-GPNMB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN |
Rabbit Polyclonal Anti-GPNMB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE |
Rabbit Polyclonal Anti-GPNMB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI5C2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI7E3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-260 of human GPNMB (NP_001005340.1). |
Modifications | Unmodified |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI5C2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI5C2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI5C2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI5C2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI7E3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI7E3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI7E3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI7E3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody,clone OTI2E10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody,clone OTI2E10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody,clone OTI2H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody,clone OTI2H7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GPNMB mouse monoclonal antibody,clone OTI2H7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GPNMB mouse monoclonal antibody,clone OTI2H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |