Rabbit Polyclonal Anti-KNSTRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C15orf23 Antibody is: synthetic peptide directed towards the middle region of Human C15orf23. Synthetic peptide located within the following region: TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL |
Rabbit Polyclonal Anti-KNSTRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C15orf23 Antibody is: synthetic peptide directed towards the N-terminal region of Human C15orf23. Synthetic peptide located within the following region: YRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMT |
KNSTRN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human KNSTRN (NP_001136233.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China