TRAF4AF1 (KNSTRN) Rabbit Polyclonal Antibody

CAT#: TA333584

Rabbit Polyclonal Anti-KNSTRN Antibody

Product Images

Host: Rabbit; Target Name: C15orf23; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C15orf23 Antibody is: synthetic peptide directed towards the middle region of Human C15orf23. Synthetic peptide located within the following region: TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: kinetochore-localized astrin/SPAG5 binding protein
• Database Link:
  NP_150628
  Entrez Gene 90417 Human
  UniProt ID Q9Y448
• Background: C15orf23 is an essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. It promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments.
• Synonyms: C15orf23; HSD11; SKAP; TRAF4AF1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 85%; Yeast: 82%; Rat: 79%