Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Keratin 15 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 15 Antibody: A synthesized peptide derived from human Keratin 15 |
Rabbit Polyclonal Anti-KRT15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT15 antibody: synthetic peptide directed towards the C terminal of human KRT15. Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI |
Mouse monoclonal Anti-Keratin15 Clone LHK15
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-KRT15 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of Human Keratin, type I cytoskeletal 15 |
Anti-KRT15 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of Human Keratin, type I cytoskeletal 15 |
Cytokeratin 15 (KRT15) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human Cytokeratin 15 (Cytokeratin 15 (KRT15)) (NP_002266.2). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- KRT15