Rabbit polyclonal Mevalonate Kinase antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Mevalonate Kinase. |
Rabbit polyclonal Mevalonate Kinase antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Mevalonate Kinase. |
Rabbit anti-MVK Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MVK |
MVK rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-MVK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK. Synthetic peptide located within the following region: LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA |
Rabbit polyclonal Anti-MVK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MVK antibody: synthetic peptide directed towards the middle region of human MVK. Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP |
Carrier-free (BSA/glycerol-free) MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MVK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MVK |
MVK rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MVK |
MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |