Antibodies

View as table Download

Rabbit Polyclonal ETO Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETO antibody: human ETO (runt-related transcription factor 1; translocated to, 1 (cyclin D-related)) using two KLH-conjugated synthetic peptides containing sequences from the N-terminal and the central region of the protein, respect

Rabbit Polyclonal AML-ETO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AML-ETO antibody: the AML-ETO (RUNX1) fusion protein, using 3 different KLH-conjugated synthetic peptides. The antibody recognizes the ETO (RUNX1T1) part of the fusion protein.

Rabbit Polyclonal Anti-RUNX1T1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA

Rabbit Polyclonal RUNX1T1/ETO Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-RUNX1T1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI

Carrier-free (BSA/glycerol-free) RUNX1T1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RUNX1T1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RUNX1T1

Runx1t1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

RUNX1T1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RUNX1T1

RUNX1T1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-390 of human RUNX1T1 (NP_783554.1).
Modifications Unmodified

RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated