Antibodies

Jump to Filters
View as table Download
SLC35C2 Rabbit Polyclonal Antibody
TA333461

USD 375.00

5 Days

Rabbit Polyclonal Anti-Slc35c2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Slc35c2 Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Slc35c2. Synthetic peptide located within the following region: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT
SLC35C2 Rabbit Polyclonal Antibody
TA362438

USD 360.00

5 Days

SLC35C2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SLC35C2