SLC35C2 Rabbit Polyclonal Antibody

CAT#: TA333461

Rabbit Polyclonal Anti-Slc35c2 Antibody

Product Images

Host: Rabbit; Target Name: Slc35c2; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc35c2 Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Slc35c2. Synthetic peptide located within the following region: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: solute carrier family 35 member C2
• Database Link:
  NP_775271
  Entrez Gene 51006 Human
  UniProt ID Q9NQQ7
• Background: The function of this protein remains unknown.
• Synonyms: BA394O2.1; C20orf5; CGI-15; OVCOV1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane