Antibodies

View as table Download

Rabbit polyclonal antibody to ZNF165 (zinc finger protein 165)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 129 and 461 of ZNF165 (Uniprot ID#P49910)

Rabbit Polyclonal Anti-ZNF165 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV

ZNF165 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Immunized with a KLH conjugated synthetic peptide between 215-242 amino acids from the Central region of human ZNF165

Rabbit Polyclonal Anti-ZNF165 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: THQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAA

Carrier-free (BSA/glycerol-free) ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human
Conjugation Unconjugated