Rabbit Polyclonal Anti-A4GALT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE |
Rabbit Polyclonal Anti-A4GALT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI |
A4GALT (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human A4GALT |
A4GALT rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human A4GALT |
A4GALT rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human A4GALT |
A4GALT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
