Rabbit Polyclonal Anti-AADACL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AADACL4 Antibody: synthetic peptide directed towards the N terminal of human AADACL4. Synthetic peptide located within the following region: FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG |
Rabbit Polyclonal Anti-AADACL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AADACL4 Antibody: synthetic peptide directed towards the middle region of human AADACL4. Synthetic peptide located within the following region: IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR |
Anti-AADACL4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 71-85 amino acids of human arylacetamide deacetylase-like 4 |
Germany
Japan
United Kingdom
China