AADACL4 Rabbit Polyclonal Antibody

CAT#: TA336098

Rabbit Polyclonal Anti-AADACL4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "AADACL4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-AADACL4 Antibody: synthetic peptide directed towards the middle region of human AADACL4. Synthetic peptide located within the following region: IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name arylacetamide deacetylase like 4
Background The function of this protein remains unknown.
Synonyms arylacetamide deacetylase-like 4; OTTHUMP00000001872
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 91%; Rat: 85%; Pig: 83%; Mouse: 82%; Guinea pig: 82%; Dog: 77%; Horse: 75%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.