Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-AAK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1 |
Antibodies
View as table Download
Rabbit polyclonal anti-AAK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AAK1. |
AAK1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the n-terminal region of human AAK1 |
Rabbit Polyclonal Aak1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aak1 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human Aak1. |
Goat Anti-AAK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GSPRTSQQNVYNPSE, from the internal region of the protein sequence according to NP_055726.3. |
Rabbit Polyclonal Anti-AAK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AAK1 antibody: synthetic peptide directed towards the C terminal of human AAK1. Synthetic peptide located within the following region: SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS |
Active filters
Target Symbol
- AAK1