Antibodies

View as table Download

Rabbit Polyclonal Anti-AAK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1

AAK1 (N-term) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen AAK1 antibody was raised against aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1.

Rabbit polyclonal anti-AAK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AAK1.

AAK1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen AAK1 antibody was raised against aak1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of the human Aak1.

Rabbit Polyclonal Aak1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1.

AAK1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the n-terminal region of human AAK1

Rabbit Polyclonal Aak1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aak1 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human Aak1.

Goat Anti-AAK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GSPRTSQQNVYNPSE, from the internal region of the protein sequence according to NP_055726.3.

Rabbit Polyclonal Anti-AAK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AAK1 antibody: synthetic peptide directed towards the C terminal of human AAK1. Synthetic peptide located within the following region: SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS

Aak1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated