Antibodies

View as table Download

Rabbit Polyclonal Anti-AAMDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AAMDC Antibody: synthetic peptide directed towards the middle region of human AAMDC. Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Rabbit Polyclonal Anti-Aamdc Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Aamdc Antibody is: synthetic peptide directed towards the N-terminal region of Rat Aamdc. Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated