C11ORF67 (AAMDC) Rabbit Polyclonal Antibody

CAT#: TA333672

Rabbit Polyclonal Anti-AAMDC Antibody

Product Images

WB Suggested Anti-C11orf67 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AAMDC Antibody: synthetic peptide directed towards the middle region of human AAMDC. Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: adipogenesis associated, Mth938 domain containing
• Database Link:
  NP_078960
  Entrez Gene 28971 Human
  UniProt ID Q9H7C9
• Background: The exact function of AAMDC remains unknown.
• Synonyms: C11orf67; CK067; PTD015
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Zebrafish: 85%