Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ABCD4 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
Antibodies
View as table Download
Rabbit anti-ABCD4 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCD4. |
Rabbit Polyclonal Anti-ABCD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL |
Rabbit Polyclonal Anti-ABCD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA |
Anti-ABCD4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCD4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
ABCD4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human ABCD4 (NP_005041.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ABCD4