Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ABCF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCF1 Antibody: A synthesized peptide derived from human ABCF1 |
Antibodies
View as table Download
Rabbit polyclonal anti-ABCF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ABCF1. |
Rabbit Polyclonal Anti-Abcf1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for Anti-Abcf1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT |
Anti-ABCF1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 625-840 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 1 |
ABCF1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ABCF1 |
ABCF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCF1. |
Active filters
Target Symbol
- ABCF1