ABCF1 Rabbit Polyclonal Antibody

CAT#: TA332251

Rabbit Polyclonal Anti-Abcf1 Antibody

Product Images

WB Suggested Anti-Abcf1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Brain

• 

  Researcher: Dr. Joanna Stewart, Centre for Biological Sciences, University of Southampton; Application: IP; Species+tissue/cell type: 1: 500 ug HEK293 cell lysate transfected with ABCF1 wt, 2: 500 ug HEK293 cell lysate untransfected, 3: 500 ug HEK293 cell

Specifications

Product Data

• Applications: IP, WB
• Recommended Dilution: IP, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Abcf1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Database Link:
  NP_001020262
  Entrez Gene 224742 Mouse
• Background: Abcf1 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Abcf1 is not involved in the ribosome biogenesis.
• Synonyms: ABC27; ABC50
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Druggable Genome