Rabbit Polyclonal Anti-ABHD13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the N terminal of human ABHD13. Synthetic peptide located within the following region: SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN |
Rabbit Polyclonal Anti-ABHD13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the C terminal of human ABHD13. Synthetic peptide located within the following region: LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII |
Germany
Japan
United Kingdom
China