Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ABHD14A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABHD14A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ABHD14A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABHD14A Antibody is: synthetic peptide directed towards the middle region of Human ABHD14A. Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP |
Rabbit Polyclonal Anti-ABHD14A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABHD14A Antibody is: synthetic peptide directed towards the C-terminal region of Human ABHD14A. Synthetic peptide located within the following region: IAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVK |
Active filters
Target Symbol
- ABHD14A