ABHD17B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABHD17B |
ABHD17B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABHD17B |
Rabbit Polyclonal Anti-FAM108B1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY |
ABHD17B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABHD17B |