Antibodies

View as table Download

ABHD17B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABHD17B

Rabbit Polyclonal Anti-FAM108B1 Antibody - middle region

Applications WB
Reactivities Human
Immunogen The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY

ABHD17B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABHD17B