FAM108B1 (ABHD17B) Rabbit Polyclonal Antibody

CAT#: TA345082

Rabbit Polyclonal Anti-FAM108B1 Antibody - middle region

Product Images

WB Suggested Anti-FAM108B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: abhydrolase domain containing 17B
• Database Link:
  NP_057098
  Entrez Gene 51104 Human
• Background: FAM108B1 belongs to the AB hydrolase superfamily.fAM108 family. The exact function of FAM108B1 remains unknown.
• Synonyms: C9orf77; CGI-67; FAM108B1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Goat: 79%

Reference Data

• Protein Families: Protease