Rabbit Polyclonal Anti-FAM175B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM175B Antibody: synthetic peptide directed towards the middle region of human FAM175B. Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV |
Rabbit Polyclonal Anti-FAM175B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM175B Antibody: synthetic peptide directed towards the middle region of human FAM175B. Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI |
Germany
Japan
United Kingdom
China