FAM175B Rabbit Polyclonal Antibody

CAT#: TA333623

Rabbit Polyclonal Anti-FAM175B Antibody

Product Images

WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysateFAM175B is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM175B Antibody: synthetic peptide directed towards the middle region of human FAM175B. Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: family with sequence similarity 175 member B
• Database Link:
  NP_115558
  Entrez Gene 23172 Human
  UniProt ID Q15018
• Background: The function of the FAM175B protein remains unknown.
• Synonyms: ABRO1; KIAA0157
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Dog: 79%; Horse: 79%; Bovine: 79%