Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ACADL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 38 of human ACADL |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACADL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADL antibody: synthetic peptide directed towards the N terminal of human ACADL. Synthetic peptide located within the following region: MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR |
Rabbit Polyclonal Anti-ACADL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADL antibody: synthetic peptide directed towards the middle region of human ACADL. Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL |
ACADL Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse ACADL |
ACADL Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-210 of human ACADL (NP_001599.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACADL