ACADL Rabbit Polyclonal Antibody

CAT#: TA334667

Rabbit Polyclonal Anti-ACADL Antibody

Product Images

WB Suggested Anti-ACADL Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACADL antibody: synthetic peptide directed towards the N terminal of human ACADL. Synthetic peptide located within the following region: MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: acyl-CoA dehydrogenase, long chain
• Database Link:
  NP_001599
  Entrez Gene 33 Human
  UniProt ID P28330
• Background: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
• Synonyms: ACAD4; LCAD
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway