Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against ACTL7B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLKMKPRKVHKIK, from the internal region of the protein sequence according to NP_006677.1. |
Antibodies
View as table Download
ACTL7B (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 68-97 amino acids from the N-terminal region of human ACTL7B |
Goat Anti-Actin-like 7B (mouse) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELHVDYELPDGK, from the internal region of the protein sequence according to NP_079547.1. |
Rabbit Polyclonal Anti-ACTL7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTL7B Antibody: synthetic peptide directed towards the middle region of human ACTL7B. Synthetic peptide located within the following region: KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA |
ACTL7B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1). |
| Modifications | Unmodified |
ACTL7B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACTL7B