Antibodies

View as table Download

Goat Polyclonal Antibody against ACTL7B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLKMKPRKVHKIK, from the internal region of the protein sequence according to NP_006677.1.

ACTL7B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 68-97 amino acids from the N-terminal region of human ACTL7B

Goat Anti-Actin-like 7B (mouse) Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DELHVDYELPDGK, from the internal region of the protein sequence according to NP_079547.1.

Rabbit Polyclonal Anti-ACTL7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTL7B Antibody: synthetic peptide directed towards the middle region of human ACTL7B. Synthetic peptide located within the following region: KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA

Anti-ACTL7B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human actin-like 7B

ACTL7B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1).
Modifications Unmodified

ACTL7B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1).
Modifications Unmodified