PACAP Receptor / PAC1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Immunogen | ADCYAP1R1 / PAC1 Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human ADCYAP1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Elephant, Panda, Horse, Pig (89%); Bovine (83%). |
Rabbit Polyclonal Anti-ADCYAP1R1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADCYAP1R1 / PAC1 Receptor antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human ADCYAP1R1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Elephant (100%); Gorilla, Panda, Pig (94%); Bovine, Dog (88%); Horse (82%). |
Rabbit Polyclonal Anti-ADCYAP1R1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCYAP1R1 antibody: synthetic peptide directed towards the C terminal of human ADCYAP1R1. Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ |
Anti-ADCYAP1R1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I |
Adcyap1r1 Antibody - C-terminal region
| Applications | IHC, IHC-F, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
ADCYAP1R1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PACR |
ADCYAP1R1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-155 of human ADCYAP1R1 (NP_001186564.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
