PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody

CAT#: TA342786

Rabbit Polyclonal Anti-ADCYAP1R1 Antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADCYAP1R1 antibody: synthetic peptide directed towards the C terminal of human ADCYAP1R1. Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: ADCYAP receptor type I
• Database Link:
  NP_001109
  Entrez Gene 117 Human
  UniProt ID P41586
• Background: This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
• Synonyms: PAC1; PAC1R; PACAPR; PACAPRI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction